PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 446aa    MW: 46690.1 Da    PI: 8.865
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006420.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.64e-19359393135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Do006420.1 359 CSHCGVNKTPQWRAGPEGAKTLCNACGVRYKSGRL 393
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.07353389IPR000679Zinc finger, GATA-type
SMARTSM004018.5E-18353407IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.28E-14356416No hitNo description
Gene3DG3DSA:3.30.50.104.7E-15357391IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.90E-15358415No hitNo description
PfamPF003204.4E-17359393IPR000679Zinc finger, GATA-type
PROSITE patternPS003440359384IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MTHQTLISSA PAFSPASHFL HAAPRLSFSP APPRHPPPAA PPLLLQPAPA MASFVAHHHG  60
SLGEREGKMA ALRSSLRPCE APEEVDAASP AAWGAADRGA GLFGDGFSVE DLLDLEDLCE  120
VDKDCTEQDE AAPAPAAVEE DKLSSDSKGS SSMVSYELMP PPPVIDLPLP AHDAEELEWV  180
SRIMDDSLAE LPPPPKLPAA PVAVAAPRRP VLERVAPAAA AGPMRSPTIC ALSTEALVPV  240
KARRSKRSRA SVWSLSGGAP LSDSTSSSST TTTSSCSSSA SFSPFFFLPA ADSPSPFWSA  300
HLLGEAPPRS NKKSKHGKHG KNGGKPKKRG RKPKHHPVPP QFAAGAAAAS APAPGDRRCS  360
HCGVNKTPQW RAGPEGAKTL CNACGVRYKS GRLLPEYRPA CSPTFVSSIH SNSHRKVLEM  420
RRKKEGVVLV PGPSPLPAAA PAVTSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953279.11e-179PREDICTED: GATA transcription factor 5-like
TrEMBLK3YSH51e-179K3YSH5_SETIT; Uncharacterized protein
STRINGSi017219m1e-178(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.24e-38GATA transcription factor 5